PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G048100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 1709aa    MW: 184072 Da    PI: 6.2931
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G048100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.21e-09847889347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE e++ + ++++G++ +++I++ +  ++t  +c+++++k+
  Seita.3G048100.2.p 847 PWTQEEKEIFMEMFAKFGKD-FSKISSFLM-HKTTADCVEFYYKH 889
                         8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819953.14E-5292391No hitNo description
SuperFamilySSF466892.17E-14833892IPR009057Homeodomain-like
PROSITE profilePS5129315.475843894IPR017884SANT domain
SMARTSM007173.1E-9844892IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-7845891IPR009057Homeodomain-like
PfamPF002491.7E-7846889IPR001005SANT/Myb domain
PROSITE profilePS5129312.35410531104IPR017884SANT domain
SMARTSM007173.5E-510541102IPR001005SANT/Myb domain
SuperFamilySSF466892.11E-810571104IPR009057Homeodomain-like
CDDcd001678.67E-410581096No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1709 aa     Download sequence    Send to blast
MPPPPPDRRD YLYREGRRHD GGGAGDPLLP PAPTPPRWRD SPYHPPPPPP LRDHARPSPR  60
RAPSSASSEG YYRQGGGAYD RSYPDEPPLG YTPSRSDRYW VEDDGGGYKS FGRYGGGGGG  120
RRDGREVRGS YRRSPFRGYG SDFSRNHPEQ PPPPPPRRSP LRSVAVPICY DPPGNRVDRG  180
DRDNLPRVTP WRRRESRSEA ADAAGAGPVS LGQTTRPASS EKEASAQPPA GSAPLGTEDE  240
APRKKARLGW GQGLAKYEKQ KVHGPADPAE AVADGSPAEA EQKTAFPVPV LPAPPASAPA  300
PEPPAAPAPP PPAVPAPPPP AAPAPLPEPP AEPVPEPPAA PAPVLVPVPA PAPAPVPAPA  360
PAPVPAPAPA PVPAPAFCTS PVDTPSSAPP YCTSAPEDKS CEQTGTVTNP TKDVPEAADK  420
AVNNEFSINL DQLGDDPINS LANMLADLLQ HDDSCSGDSK GPTSTSKLLL LKESISKEIE  480
KTELEIDLLE GELKSVNTEA GTAVEGSPTG VTYAENLSPS SGTSKVPESA EISQASHVMK  540
EPGELIPSPK PPVVQDADVK GADMMEIEPA PVRNAKTLSS EESAVSPGVA EGPVCAAADL  600
SPLKASERAG SQNDMHNDRL ETSSCHVNAD SIKTEISDDI PVTQCSDHDH KYSLFGSVTS  660
ANNNIAKVMN ESLFKSLPAD TPHLDLLASS HLLSQRKNDH HIRERLGVCK NRLRLKEQIL  720
TLKFKAYRHL WKEDLRLLSA KKQRPKSNKR IDQSNRTSHI GSQRQRSSNR SRLAMPAGNL  780
STFSTPEMSD VASKLFSEFQ IKRCRNYLKM PALIIDEREK ERSRFVSKNG FVDDPVLVEK  840
ERVMINPWTQ EEKEIFMEMF AKFGKDFSKI SSFLMHKTTA DCVEFYYKHH KSDSFREVKK  900
LLDLRQQQPA SNFLGAKSGK KWNPEANAAS LDMLGVASVV AAHGLEYANR VEKISAKSLI  960
RTAYGSNVSF AAKKSSDMEC IDNVPLHERE SVAADVLAGI CSTLSPEGMG SCITSSADPG  1020
QKISMTRMEH GLAPEIDRSI DEEDTLSDQE CEVDPVDWND DEKSVFIEAM NNYGKDFARI  1080
SSCVKSKSYE QCKVFFSKAR KSLGLDLIHQ GAADVSMPTS DTNGGRSDTD EACAAEMDSA  1140
ICSTQSCSEI EKDVCPTEKA IGGIITKQPE LNISNGFDVV DGKTEEDEKK ADKNCSIVDH  1200
GRFNEDTHQV ACGTIDINCP ESTEKLQGKD DVVDQVNMQN NSAISSSPEQ AMAAHPEVRS  1260
SLHSVEVLHQ TNKAPLGSGT DASQMEECSN QALDNKLRKA GNSGASACIA SDISTKDNVH  1320
FANMTGASTI SPAFPPSYKH SVPADMPPTK PKPLVTPLTP KDLMPVQFSS AVPDPTVICF  1380
DGIASITMPN FDDSGNRVSS ALGAKDMSKY PAFKDPTGNQ HDALFRNVDG YTNHLTTKLP  1440
FFSERTASGT VSTSQTDRFT LTKFQNGRSS SLGLPNTSDG IQWARKHEEV LQGSLRSCSH  1500
NTSSEGDEQQ KRPGDVKLFG KILSHQSSLQ SPVPPCNGNK SKPPSPKIDI SSVRSLNNPR  1560
DRVVCSSRPG ITHLGLEERT AKSYGHLDGS TTQPEPLLMM AKCQSLAGVP FYSAKNGTVG  1620
VFSDYQQPSI QPHQSDPKRL ERFSDPQKRN GVEFISGFQQ PSKISRFGGA GILVSGVSDP  1680
VAALKAQYGP GSKVMGSDVD PWKDIGSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D4e-16805896494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C4e-16805896494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLK7UY070.0K7UY07_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G089406_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-83MYB family protein